PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.004G146200.1
Common NamePHAVU_004G146200g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family ZF-HD
Protein Properties Length: 173aa    MW: 18923.1 Da    PI: 8.2904
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.004G146200.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer91.48.3e-291163357
         ZF-HD_dimer  3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrev 57
                        +  Y+eCl+NhAaslG++a+DGCgEf+ +   + ++++l+CaACgCHRnFHR+ +
  Phvul.004G146200.1 11 NSIYRECLRNHAASLGSYATDGCGEFTLD--IDVSSSTLQCAACGCHRNFHRKVT 63
                        678*************************8..667899***************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF047701.2E-231363IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152322.6031462IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257745.0E-201461IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015662.0E-231461IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Gene3DG3DSA:1.10.10.608.8E-2889159IPR009057Homeodomain-like
SuperFamilySSF466897.77E-1591157IPR009057Homeodomain-like
TIGRFAMsTIGR015657.4E-2998156IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 173 aa     Download sequence    Send to blast
MENSSSSSSS NSIYRECLRN HAASLGSYAT DGCGEFTLDI DVSSSTLQCA ACGCHRNFHR  60
KVTCPLAVEG LAGGGSGDMM EYSGGDVGRM EVGERSSRKR FRTKFSAEQK EKMLGFAEKL  120
GWKLQRKEVD DEIERFCKSV GVTRQVFKVW MHNHKNNSNS SNSSANLSSL TQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A6e-23991611879ZF-HD homeobox family protein
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150441e-166AP015044.1 Vigna angularis var. angularis DNA, chromosome 11, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007152632.11e-125hypothetical protein PHAVU_004G146200g
SwissprotQ9M9S08e-40ZHD4_ARATH; Zinc-finger homeodomain protein 4
TrEMBLV7C6U41e-125V7C6U4_PHAVU; Uncharacterized protein
STRINGGLYMA09G30061.13e-91(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF79822844
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14440.22e-32homeobox protein 31